|
BBOV_I000480 | BBOV_I000480-t26_1 | 1 | 1 | 1 | | 276 | reverse | protein coding | No | 1494 | BBOV_I000480 | tat-binding protein-like protein | tat-binding protein-like protein | 5476913 | A7AX69 | Not Assigned | AAXT01000006:129,396..130,889(-) | AAXT01000006:129396..130613(-) | AAXT01000006 | Babesia bovis T2Bo | 9 | OG6_101513 | 0 | 405 | 1218 | 45629 | 7.92 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.3 (Transferred entry: 5.6.1.1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I000480ORtat-binding protein-like proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I000480 OR tat-binding protein-like protein AND Babesia bovis T2Bo |
|
BBOV_I000540 | BBOV_I000540-t26_1 | 7 | 7 | 1 | | | forward | protein coding | No | 1641 | BBOV_I000540 | preprocathepsin c precursor, putative | preprocathepsin c precursor, putative | 5476919 | A7AX75 | Not Assigned | AAXT01000006:140,974..142,827(+) | AAXT01000006:140974..142827(+) | AAXT01000006 | Babesia bovis T2Bo | 17 | OG6_103622 | 1 | 546 | 1641 | 61346 | 6.26 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I000540ORpreprocathepsin c precursor, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I000540 OR preprocathepsin c precursor, putative AND Babesia bovis T2Bo |
|
BBOV_I001480 | BBOV_I001480-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 753 | BBOV_I001480 | proteasome alpha 5 subunit, putative | proteasome alpha 5 subunit, putative | 5477005 | A7AW04 | Not Assigned | AAXT01000005:44,269..45,124(+) | AAXT01000005:44269..45124(+) | AAXT01000005 | Babesia bovis T2Bo | 9 | OG6_101621 | 0 | 250 | 753 | 28051 | 4.69 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I001480ORproteasome alpha 5 subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I001480 OR proteasome alpha 5 subunit, putative AND Babesia bovis T2Bo |
|
BBOV_I002290 | BBOV_I002290-t26_1 | 3 | 3 | 1 | 157 | 24 | forward | protein coding | No | 769 | BBOV_I002290 | 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative | 5477095 | A7AW83 | Not Assigned | AAXT01000005:192,969..193,894(+) | AAXT01000005:192993..193737(+) | AAXT01000005 | Babesia bovis T2Bo | 8 | OG6_101257 | 0 | 195 | 588 | 20476 | 8.37 | 0 | | | | | | | | | | | | | | | | 2.7.1.50 (Hydroxyethylthiazole kinase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I002290OR4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I002290 OR 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative AND Babesia bovis T2Bo |
|
BBOV_I002820 | BBOV_I002820-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 963 | BBOV_I002820 | conserved hypothetical protein | conserved hypothetical protein | 5477148 | A7AWD6 | Not Assigned | AAXT01000005:296,596..297,697(+) | AAXT01000005:296596..297697(+) | AAXT01000005 | Babesia bovis T2Bo | 11 | OG6_104644 | 0 | 320 | 963 | 36310 | 5.41 | 0 | | | | | GO:0005515;GO:0004843 | protein binding;thiol-dependent ubiquitin-specific protease activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I002820ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I002820 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_I003700 | BBOV_I003700-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1359 | BBOV_I003700 | hypothetical protein | hypothetical protein | 5477236 | A7AWM4 | Not Assigned | AAXT01000005:498,074..499,468(-) | AAXT01000005:498074..499468(-) | AAXT01000005 | Babesia bovis T2Bo | 11 | OG6_124366 | 0 | 452 | 1359 | 50998 | 9.60 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I003700ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I003700 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_I003710 | BBOV_I003710-t26_1 | 3 | 3 | 1 | 86 | 12 | reverse | protein coding | No | 377 | BBOV_I003710 | hypothetical protein | hypothetical protein | 5477237 | A7AWM5 | Not Assigned | AAXT01000005:499,776..500,272(-) | AAXT01000005:499862..500260(-) | AAXT01000005 | Babesia bovis T2Bo | 8 | OG6_194527 | 0 | 92 | 279 | 10475 | 10.38 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I003710ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I003710 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_I004260 | BBOV_I004260-t26_1 | 3 | 3 | 1 | 10 | 66 | forward | protein coding | No | 535 | BBOV_I004260 | conserved hypothetical protein | conserved hypothetical protein | 5477291 | A7AWS9 | Not Assigned | AAXT01000005:622,747..623,355(+) | AAXT01000005:622813..623345(+) | AAXT01000005 | Babesia bovis T2Bo | 8 | OG6_100609 | 0 | 152 | 459 | 16691 | 9.54 | 0 | | | | | | | | | | | | | | | | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I004260ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I004260 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_I004450 | BBOV_I004450-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 657 | BBOV_I004450 | proteasome beta 2 subunit, putative | proteasome beta 2 subunit, putative | 5477310 | A7AWU8 | Not Assigned | AAXT01000005:660,308..661,123(+) | AAXT01000005:660308..661123(+) | AAXT01000005 | Babesia bovis T2Bo | 9 | OG6_102061 | 0 | 218 | 657 | 24590 | 6.16 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_I004450ORproteasome beta 2 subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_I004450 OR proteasome beta 2 subunit, putative AND Babesia bovis T2Bo |
|
BBOV_II000170 | BBOV_II000170-t26_1 | 4 | 4 | 1 | 8 | 25 | forward | protein coding | No | 1626 | BBOV_II000170 | cathepsin C precursor, putative | cathepsin C precursor, putative | 5477769 | A7ASR7 | 2 | AAXT01000003:40,948..42,754(+) | AAXT01000003:40973..42746(+) | AAXT01000003 | Babesia bovis T2Bo | 17 | OG6_103622 | 1 | 530 | 1593 | 59661 | 6.81 | 1 | HMM: MLDRAPNCEHVITMVLLLFFVQLILGI, NN: MLDRAPNCEHVITMVLLLFFVQLILGI | NN Sum: 4, NN D: .77, HMM Prob: .2 | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.14.1 (Dipeptidyl-peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II000170ORcathepsin C precursor, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II000170 OR cathepsin C precursor, putative AND Babesia bovis T2Bo |
|
BBOV_II000230 | BBOV_II000230-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1632 | BBOV_II000230 | putative serine esterase domain containing protein | putative serine esterase domain containing protein | 5477775 | A7ASS3 | 2 | AAXT01000003:55,834..57,465(+) | AAXT01000003:55834..57465(+) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_154686 | 0 | 543 | 1632 | 61361 | 6.91 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II000230ORputative serine esterase domain containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II000230 OR putative serine esterase domain containing protein AND Babesia bovis T2Bo |
|
BBOV_II000870 | BBOV_II000870-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 2121 | BBOV_II000870 | ATP-dependent metalloprotease FtsH family protein | ATP-dependent metalloprotease FtsH family protein | 5477839 | A7ASY6 | 2 | AAXT01000003:225,488..227,711(+) | AAXT01000003:225488..227711(+) | AAXT01000003 | Babesia bovis T2Bo | 13 | OG6_101196 | 1 | 706 | 2121 | 78443 | 8.82 | 0 | HMM: MLIALTSGVRPIRFVWAT, NN: MLIALTSGVRPIRFVWAT | NN Sum: 3, NN D: .44, HMM Prob: .05 | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II000870ORATP-dependent metalloprotease FtsH family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II000870 OR ATP-dependent metalloprotease FtsH family protein AND Babesia bovis T2Bo |
|
BBOV_II000950 | BBOV_II000950-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 474 | BBOV_II000950 | hypothetical protein | hypothetical protein | 5477847 | A7ASZ4 | 2 | AAXT01000003:250,400..250,944(-) | AAXT01000003:250400..250944(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_104384 | 0 | 157 | 474 | 18675 | 6.30 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II000950ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II000950 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II001080 | BBOV_II001080-t26_1 | 1 | 1 | 1 | 23 | | forward | protein coding | No | 3131 | BBOV_II001080 | hypothetical protein | hypothetical protein | 5477860 | A7AT06 | 2 | AAXT01000003:272,780..275,910(+) | AAXT01000003:272780..275887(+) | AAXT01000003 | Babesia bovis T2Bo | 12 | OG6_119794 | 1 | 1035 | 3108 | 112947 | 7.45 | 0 | | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II001080ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II001080 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II001130 | BBOV_II001130-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 3417 | BBOV_II001130 | hypothetical protein | hypothetical protein | 5477865 | A7AT11 | 2 | AAXT01000003:286,144..289,633(+) | AAXT01000003:286144..289633(+) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_110270 | 0 | 1138 | 3417 | 129031 | 5.28 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II001130ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II001130 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II001460 | BBOV_II001460-t26_1 | 3 | 3 | 1 | 78 | | forward | protein coding | No | 1023 | BBOV_II001460 | mov34/MPN/PAD-1 family protein | mov34/MPN/PAD-1 family protein | 5477898 | A7AT42 | 2 | AAXT01000003:368,259..369,556(+) | AAXT01000003:368259..369478(+) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_103242 | 0 | 314 | 945 | 35081 | 5.56 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II001460ORmov34/MPN/PAD-1 family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II001460 OR mov34/MPN/PAD-1 family protein AND Babesia bovis T2Bo |
|
BBOV_II001800 | BBOV_II001800-t26_1 | 5 | 5 | 1 | | 35 | reverse | protein coding | No | 770 | BBOV_II001800 | hypothetical protein | hypothetical protein | 5477932 | A7AT76 | 2 | AAXT01000003:441,566..442,472(-) | AAXT01000003:441566..442437(-) | AAXT01000003 | Babesia bovis T2Bo | 5 | OG6_102579 | 0 | 244 | 735 | 27727 | 8.19 | 0 | | | | | | | | | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II001800ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II001800 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II002240 | BBOV_II002240-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 972 | BBOV_II002240 | hypothetical protein | hypothetical protein | 5477976 | A7ATB9 | 2 | AAXT01000003:538,688..539,693(+) | AAXT01000003:538688..539693(+) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_102002 | 0 | 323 | 972 | 35903 | 4.35 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II002240ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II002240 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II002330 | BBOV_II002330-t26_1 | 5 | 5 | 1 | 29 | | reverse | protein coding | No | 860 | BBOV_II002330 | proteasome subunit alpha type 6 protein, putative | proteasome subunit alpha type 6 protein, putative | 5477985 | A7ATC8 | 2 | AAXT01000003:571,116..572,263(-) | AAXT01000003:571145..572263(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_102240 | 0 | 276 | 831 | 30620 | 5.37 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II002330ORproteasome subunit alpha type 6 protein, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II002330 OR proteasome subunit alpha type 6 protein, putative AND Babesia bovis T2Bo |
|
BBOV_II002340 | BBOV_II002340-t26_1 | 1 | 1 | 1 | | 172 | forward | protein coding | No | 1636 | BBOV_II002340 | hypothetical protein | hypothetical protein | 5477986 | A7ATC9 | 2 | AAXT01000003:573,829..575,464(+) | AAXT01000003:574001..575464(+) | AAXT01000003 | Babesia bovis T2Bo | 7 | OG6_102873 | 0 | 487 | 1464 | 54619 | 7.86 | 0 | | | | | GO:0008236 | serine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.83 (Oligopeptidase B) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II002340ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II002340 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II002690 | BBOV_II002690-t26_1 | 2 | 2 | 1 | 87 | | reverse | protein coding | No | 2775 | BBOV_II002690 | transcriptional regulator, putative | transcriptional regulator, putative | 5478021 | A7ATG3 | 2 | AAXT01000003:642,704..645,513(-) | AAXT01000003:642791..645513(-) | AAXT01000003 | Babesia bovis T2Bo | 10 | OG6_102309 | 0 | 895 | 2688 | 102646 | 4.60 | 0 | | | | | | | | | | | | | | | | 1.1.1.27 (L-lactate dehydrogenase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II002690ORtranscriptional regulator, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II002690 OR transcriptional regulator, putative AND Babesia bovis T2Bo |
|
BBOV_II002710 | BBOV_II002710-t26_1 | 7 | 7 | 1 | 1309 | | reverse | protein coding | No | 1963 | BBOV_II002710 | proteasome A-type and B-type family protein | proteasome A-type and B-type family protein | 5478023 | A7ATG6 | 2 | AAXT01000003:647,543..649,749(-) | AAXT01000003:648852..649749(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101631 | 0 | 217 | 654 | 24180 | 6.85 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II002710ORproteasome A-type and B-type family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II002710 OR proteasome A-type and B-type family protein AND Babesia bovis T2Bo |
|
BBOV_II003000 | BBOV_II003000-t26_1 | 1 | 1 | 1 | 16 | | forward | protein coding | No | 1093 | BBOV_II003000 | glycoprotease family protein | glycoprotease family protein | 5478052 | A7ATJ4 | 2 | AAXT01000003:697,281..698,373(+) | AAXT01000003:697281..698357(+) | AAXT01000003 | Babesia bovis T2Bo | 19 | OG6_100288 | 1 | 358 | 1077 | 38620 | 7.06 | 0 | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II003000ORglycoprotease family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II003000 OR glycoprotease family protein AND Babesia bovis T2Bo |
|
BBOV_II003250 | BBOV_II003250-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 2199 | BBOV_II003250 | eukaryotic translation initiation factor 3 subunit, putative | eukaryotic translation initiation factor 3 subunit, putative | 5478077 | A7ATL9 | 2 | AAXT01000003:747,974..750,487(-) | AAXT01000003:747974..750487(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101924 | 0 | 732 | 2199 | 85564 | 4.87 | 0 | | | GO:0005852 | eukaryotic translation initiation factor 3 complex | GO:0003723;GO:0003676;GO:0003743;GO:0031369 | RNA binding;nucleic acid binding;translation initiation factor activity;translation initiation factor binding | GO:0006413 | translational initiation | | | | | | | | 3.6.3.14 (Transferred entry: 7.1.2.2) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II003250OReukaryotic translation initiation factor 3 subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II003250 OR eukaryotic translation initiation factor 3 subunit, putative AND Babesia bovis T2Bo |
|
BBOV_II003480 | BBOV_II003480-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 921 | BBOV_II003480 | 26S proteasome regulatory particle non-ATPase subunit8, putative | 26S proteasome regulatory particle non-ATPase subunit8, putative | 5478100 | A7ATP2 | 2 | AAXT01000003:806,821..807,927(-) | AAXT01000003:806821..807927(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_102054 | 0 | 306 | 921 | 34683 | 7.08 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II003480OR26S proteasome regulatory particle non-ATPase subunit8, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II003480 OR 26S proteasome regulatory particle non-ATPase subunit8, putative AND Babesia bovis T2Bo |
|
BBOV_II003900 | BBOV_II003900-t26_1 | 4 | 4 | 1 | 40 | | reverse | protein coding | No | 1255 | BBOV_II003900 | 26S proteasome AAA-ATPase subunit RPT4a, putative | 26S proteasome AAA-ATPase subunit RPT4a, putative | 5478142 | A7ATT4 | 2 | AAXT01000003:899,442..901,106(-) | AAXT01000003:899482..901106(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101751 | 0 | 404 | 1215 | 45509 | 9.08 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II003900OR26S proteasome AAA-ATPase subunit RPT4a, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II003900 OR 26S proteasome AAA-ATPase subunit RPT4a, putative AND Babesia bovis T2Bo |
|
BBOV_II004070 | BBOV_II004070-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 678 | BBOV_II004070 | ATP-dependent Clp protease proteolytic subunit 1, putative | ATP-dependent Clp protease proteolytic subunit 1, putative | 5478159 | A7ATV1 | 2 | AAXT01000003:944,830..945,580(+) | AAXT01000003:944830..945580(+) | AAXT01000003 | Babesia bovis T2Bo | 15 | OG6_100939 | 2 | 225 | 678 | 25445 | 7.30 | 0 | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004070ORATP-dependent Clp protease proteolytic subunit 1, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004070 OR ATP-dependent Clp protease proteolytic subunit 1, putative AND Babesia bovis T2Bo |
|
BBOV_II004090 | BBOV_II004090-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1173 | BBOV_II004090 | ulp1 protease family, C-terminal catalytic domain containing protein | ulp1 protease family, C-terminal catalytic domain containing protein | 5478161 | A7ATV3 | 2 | AAXT01000003:949,842..951,014(-) | AAXT01000003:949842..951014(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101235 | 0 | 390 | 1173 | 45636 | 6.59 | 0 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.68 (Ulp1 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004090ORulp1 protease family, C-terminal catalytic domain containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004090 OR ulp1 protease family, C-terminal catalytic domain containing protein AND Babesia bovis T2Bo |
|
BBOV_II004100 | BBOV_II004100-t26_1 | 4 | 4 | 1 | | 5 | forward | protein coding | No | 2801 | BBOV_II004100 | ClpB, putative | ClpB, putative | 5478162 | A7ATV4 | 2 | AAXT01000003:952,352..955,786(+) | AAXT01000003:952357..955786(+) | AAXT01000003 | Babesia bovis T2Bo | 27 | OG6_100223 | 4 | 931 | 2796 | 104834 | 6.33 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004100ORClpB, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004100 OR ClpB, putative AND Babesia bovis T2Bo |
|
BBOV_II004450 | BBOV_II004450-t26_1 | 5 | 5 | 1 | 35 | | forward | protein coding | No | 1613 | BBOV_II004450 | leucine aminopeptidase, putative | leucine aminopeptidase, putative | 5478197 | A7ATY9 | 2 | AAXT01000003:1,045,409..1,047,164(+) | AAXT01000003:1045409..1047129(+) | AAXT01000003 | Babesia bovis T2Bo | 11 | OG6_100682 | 0 | 525 | 1578 | 56605 | 4.97 | 0 | | | GO:0005622 | intracellular | GO:0004177 | aminopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.11.1 (Leucyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004450ORleucine aminopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004450 OR leucine aminopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_II004550 | BBOV_II004550-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 303 | BBOV_II004550 | conserved hypothetical protein | conserved hypothetical protein | 5478207 | A7ATZ9 | 2 | AAXT01000003:1,073,010..1,073,312(+) | AAXT01000003:1073010..1073312(+) | AAXT01000003 | Babesia bovis T2Bo | 8 | OG6_102356 | 0 | 100 | 303 | 11629 | 5.59 | 0 | | | | | | | | | | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004550ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004550 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II004840 | BBOV_II004840-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2946 | BBOV_II004840 | hypothetical protein | hypothetical protein | 5478236 | A7AU28 | 2 | AAXT01000003:1,126,071..1,129,016(+) | AAXT01000003:1126071..1129016(+) | AAXT01000003 | Babesia bovis T2Bo | 11 | OG6_156430 | 0 | 981 | 2946 | 111246 | 7.86 | 5 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004840ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004840 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II004890 | BBOV_II004890-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3501 | BBOV_II004890 | peptidase M16 inactive domain containing protein | peptidase M16 inactive domain containing protein | 5478241 | A7AU33 | 2 | AAXT01000003:1,138,858..1,142,358(+) | AAXT01000003:1138858..1142358(+) | AAXT01000003 | Babesia bovis T2Bo | 11 | OG6_101809 | 0 | 1166 | 3501 | 131375 | 6.06 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004890ORpeptidase M16 inactive domain containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004890 OR peptidase M16 inactive domain containing protein AND Babesia bovis T2Bo |
|
BBOV_II004930 | BBOV_II004930-t26_1 | 6 | 6 | 1 | | 1 | forward | protein coding | No | 1201 | BBOV_II004930 | 26s proteasome aaa-ATPase subunit Rpt3, putative | 26s proteasome aaa-ATPase subunit Rpt3, putative | 5478245 | A7AU36 | 2 | AAXT01000003:1,153,193..1,154,660(+) | AAXT01000003:1153194..1154660(+) | AAXT01000003 | Babesia bovis T2Bo | 8 | OG6_101965 | 0 | 399 | 1200 | 45290 | 7.68 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II004930OR26s proteasome aaa-ATPase subunit Rpt3, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II004930 OR 26s proteasome aaa-ATPase subunit Rpt3, putative AND Babesia bovis T2Bo |
|
BBOV_II005180 | BBOV_II005180-t26_1 | 9 | 9 | 1 | | | reverse | protein coding | No | 1413 | BBOV_II005180 | u4/u6.u5 tri-snRNP-associated 65 kDa protein, putative | u4/u6.u5 tri-snRNP-associated 65 kDa protein, putative | 5478270 | A7AU59 | 2 | AAXT01000003:1,188,091..1,189,899(-) | AAXT01000003:1188091..1189899(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_102786 | 0 | 470 | 1413 | 53625 | 7.76 | 0 | | | | | GO:0036459;GO:0008270 | thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005180ORu4/u6.u5 tri-snRNP-associated 65 kDa protein, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005180 OR u4/u6.u5 tri-snRNP-associated 65 kDa protein, putative AND Babesia bovis T2Bo |
|
BBOV_II005380 | BBOV_II005380-t26_1 | 2 | 2 | 1 | 337 | | forward | protein coding | No | 1675 | BBOV_II005380 | hypothetical protein | hypothetical protein | 5478290 | A7AU78 | 2 | AAXT01000003:1,217,610..1,219,319(+) | AAXT01000003:1217610..1218982(+) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_102202 | 0 | 445 | 1338 | 50607 | 8.06 | 0 | | | | | GO:1990380;GO:0004843 | Lys48-specific deubiquitinase activity;thiol-dependent ubiquitin-specific protease activity | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005380ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005380 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II005540 | BBOV_II005540-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 621 | BBOV_II005540 | hypothetical protein | hypothetical protein | 5478306 | A7AU94 | 2 | AAXT01000003:1,253,712..1,254,554(+) | AAXT01000003:1253712..1254554(+) | AAXT01000003 | Babesia bovis T2Bo | 7 | OG6_100501 | 0 | 206 | 621 | 23821 | 7.99 | 0 | | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005540ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005540 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II005930 | BBOV_II005930-t26_1 | 4 | 4 | 1 | 44 | | reverse | protein coding | No | 2396 | BBOV_II005930 | rhomboid 4 | rhomboid 4 | 5478345 | A7AUD2 | 2 | AAXT01000003:1,343,175..1,345,678(-) | AAXT01000003:1343219..1345678(-) | AAXT01000003 | Babesia bovis T2Bo | 4 | OG6_106921 | 3 | 783 | 2352 | 85981 | 10.05 | 4 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005930ORrhomboid 4ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005930 OR rhomboid 4 AND Babesia bovis T2Bo |
|
BBOV_II005940 | BBOV_II005940-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1926 | BBOV_II005940 | rhomboid 4 | rhomboid 4 | 5478346 | A7AUD3 | 2 | AAXT01000003:1,346,426..1,348,423(-) | AAXT01000003:1346426..1348423(-) | AAXT01000003 | Babesia bovis T2Bo | 4 | OG6_106921 | 3 | 641 | 1926 | 71075 | 9.73 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005940ORrhomboid 4ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005940 OR rhomboid 4 AND Babesia bovis T2Bo |
|
BBOV_II005950 | BBOV_II005950-t26_1 | 4 | 4 | 1 | 70 | | reverse | protein coding | No | 1960 | BBOV_II005950 | rhomboid 4 | rhomboid 4 | 5478347 | A7AUD4 | 2 | AAXT01000003:1,349,101..1,351,168(-) | AAXT01000003:1349171..1351168(-) | AAXT01000003 | Babesia bovis T2Bo | 4 | OG6_106921 | 3 | 629 | 1890 | 69698 | 9.81 | 7 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005950ORrhomboid 4ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005950 OR rhomboid 4 AND Babesia bovis T2Bo |
|
BBOV_II005970 | BBOV_II005970-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 801 | BBOV_II005970 | proteosome A, putative | proteosome A, putative | 5478349 | A7AUD6 | 2 | AAXT01000003:1,353,243..1,354,043(-) | AAXT01000003:1353243..1354043(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101390 | 0 | 266 | 801 | 29002 | 5.30 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II005970ORproteosome A, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II005970 OR proteosome A, putative AND Babesia bovis T2Bo |
|
BBOV_II006070 | BBOV_II006070-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1221 | BBOV_II006070 | conserved hypothetical protein | conserved hypothetical protein | 5478359 | A7AUE6 | 2 | AAXT01000003:1,370,986..1,372,581(+) | AAXT01000003:1370986..1372581(+) | AAXT01000003 | Babesia bovis T2Bo | 4 | OG6_106921 | 3 | 406 | 1221 | 46700 | 8.93 | 5 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II006070ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II006070 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_II006080 | BBOV_II006080-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2088 | BBOV_II006080 | subtilisin-like protein, putative | subtilisin-like protein, putative | 5478360 | A7AUE7 | 2 | AAXT01000003:1,373,827..1,375,914(-) | AAXT01000003:1373827..1375914(-) | AAXT01000003 | Babesia bovis T2Bo | 4 | OG6_121085 | 0 | 695 | 2088 | 77372 | 9.18 | 0 | HMM: MRWLLELGLTFTLLIIVDQNTATA, NN: MRWLLELGLTFTLLIIVDQNTATA | NN Sum: 4, NN D: .73, HMM Prob: .99 | | | GO:0004252 | serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.62 (Subtilisin) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II006080ORsubtilisin-like protein, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II006080 OR subtilisin-like protein, putative AND Babesia bovis T2Bo |
|
BBOV_II006100 | BBOV_II006100-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 945 | BBOV_II006100 | rhomboid 4 | rhomboid 4 | 5478362 | A7AUE9 | 2 | AAXT01000003:1,378,723..1,379,879(-) | AAXT01000003:1378723..1379879(-) | AAXT01000003 | Babesia bovis T2Bo | 13 | OG6_126349 | 0 | 314 | 945 | 35591 | 9.51 | 5 | HMM: MMYKQDWGFMRTMGLFLISGIGGNLTGAVLS, NN: MMYKQDWGFMRTMGLFLISGIGGN | NN Sum: 2, NN D: .56, HMM Prob: .57 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II006100ORrhomboid 4ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II006100 OR rhomboid 4 AND Babesia bovis T2Bo |
|
BBOV_II006840 | BBOV_II006840-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1047 | BBOV_II006840 | alpha/beta hydrolase protein, putative | alpha/beta hydrolase protein, putative | 5478436 | A7AUM3 | 2 | AAXT01000003:1,539,864..1,540,964(-) | AAXT01000003:1539864..1540964(-) | AAXT01000003 | Babesia bovis T2Bo | 8 | OG6_129556 | 0 | 348 | 1047 | 38521 | 7.71 | 0 | | | | | | | | | | | | | | | | 3.4.11.- (Aminopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II006840ORalpha/beta hydrolase protein, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II006840 OR alpha/beta hydrolase protein, putative AND Babesia bovis T2Bo |
|
BBOV_II007180 | BBOV_II007180-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 4617 | BBOV_II007180 | Sma protein, putative | Sma protein, putative | 5478470 | A7AUQ7 | 2 | AAXT01000003:1,606,414..1,611,065(-) | AAXT01000003:1606414..1611065(-) | AAXT01000003 | Babesia bovis T2Bo | 13 | OG6_126374 | 1 | 1538 | 4617 | 175896 | 7.82 | 0 | | | | | | | | | | | | | | | | 1.3.-.- (Acting on the CH-CH group of donors.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II007180ORSma protein, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II007180 OR Sma protein, putative AND Babesia bovis T2Bo |
|
BBOV_II007340 | BBOV_II007340-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1437 | BBOV_II007340 | erythrocyte membrane-associated antigen | erythrocyte membrane-associated antigen | 5478486 | A7AUS3 | 2 | AAXT01000003:1,648,437..1,649,908(-) | AAXT01000003:1648437..1649908(-) | AAXT01000003 | Babesia bovis T2Bo | 10 | OG6_124535 | 1 | 478 | 1437 | 52836 | 4.52 | 0 | HMM: MCSRRHSCAMLLFLLAFCNSVVNGV, NN: MCSRRHSCAMLLFLLAFCNSVVNGV | NN Sum: 4, NN D: .89, HMM Prob: 1 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II007340ORerythrocyte membrane-associated antigenANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II007340 OR erythrocyte membrane-associated antigen AND Babesia bovis T2Bo |
|
BBOV_II007410 | BBOV_II007410-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 1413 | BBOV_II007410 | erythrocyte membrane-associated antigen | erythrocyte membrane-associated antigen | 5478493 | A7AUT0 | 2 | AAXT01000003:1,657,385..1,658,832(-) | AAXT01000003:1657385..1658832(-) | AAXT01000003 | Babesia bovis T2Bo | 10 | OG6_124535 | 1 | 470 | 1413 | 52203 | 4.55 | 0 | HMM: MLLFLLAFCNSIVNVLTD, NN: MLLFLLAFCNSIVNVLTD | NN Sum: 4, NN D: .72, HMM Prob: .91 | | | | | | | | | | | | | | 3.1.3.16 (Protein-serine/threonine phosphatase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II007410ORerythrocyte membrane-associated antigenANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II007410 OR erythrocyte membrane-associated antigen AND Babesia bovis T2Bo |
|
BBOV_II007480 | BBOV_II007480-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 939 | BBOV_II007480 | 26S proteasome regulatory subunit, putative | 26S proteasome regulatory subunit, putative | 5478500 | A7AUT7 | 2 | AAXT01000003:1,670,576..1,671,662(-) | AAXT01000003:1670576..1671662(-) | AAXT01000003 | Babesia bovis T2Bo | 9 | OG6_101835 | 0 | 312 | 939 | 35008 | 7.08 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_II007480OR26S proteasome regulatory subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_II007480 OR 26S proteasome regulatory subunit, putative AND Babesia bovis T2Bo |
|
BBOV_III000270 | BBOV_III000270-t26_1 | 2 | 2 | 1 | 44 | | forward | protein coding | No | 596 | BBOV_III000270 | signal peptidase, putative | signal peptidase, putative | 5479407 | A7AM10 | 3 | AAXT01000001:60,388..61,366(+) | AAXT01000001:60388..61322(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_100807 | 0 | 183 | 552 | 20548 | 8.68 | 0 | | | GO:0016020 | membrane | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | 3.4.21.89 (Signal peptidase I) | 3.4.21.89 (Signal peptidase I) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III000270ORsignal peptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III000270 OR signal peptidase, putative AND Babesia bovis T2Bo |
|
BBOV_III000310 | BBOV_III000310-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 711 | BBOV_III000310 | proteasome A-type and B-type family protein | proteasome A-type and B-type family protein | 5479411 | A7AM14 | 3 | AAXT01000001:65,954..66,996(-) | AAXT01000001:65954..66996(-) | AAXT01000001 | Babesia bovis T2Bo | 8 | OG6_101969 | 0 | 236 | 711 | 25778 | 4.57 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III000310ORproteasome A-type and B-type family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III000310 OR proteasome A-type and B-type family protein AND Babesia bovis T2Bo |
|
BBOV_III000530 | BBOV_III000530-t26_1 | 1 | 1 | 1 | 25 | 182 | forward | protein coding | No | 1698 | BBOV_III000530 | rhomboid family protein | rhomboid family protein | 5479433 | A7AM36 | 3 | AAXT01000001:126,070..127,767(+) | AAXT01000001:126252..127742(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_150993 | 0 | 496 | 1491 | 55552 | 9.99 | 3 | HMM: MCKCCAVVPSQHVNVSRKQYTMLMFVFFYMCIFATSEVVSL, NN: MCKCCAVVPSQHVNVSRKQYTMLMFVFFYMCIFATSE | NN Sum: 4, NN D: .51, HMM Prob: .12 | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | | 3.4.21.105 (Rhomboid protease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III000530ORrhomboid family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III000530 OR rhomboid family protein AND Babesia bovis T2Bo |
|
BBOV_III000740 | BBOV_III000740-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1392 | BBOV_III000740 | hypothetical protein | hypothetical protein | 5479454 | A7AM57 | 3 | AAXT01000001:189,689..191,080(-) | AAXT01000001:189689..191080(-) | AAXT01000001 | Babesia bovis T2Bo | 8 | OG6_112025 | 0 | 463 | 1392 | 51942 | 9.53 | 5 | HMM: MMMLMLPSKLYPIIICIFLYELVKHNIEAV, NN: MMMLMLPSKLYPIIICIFLYELVKHNIEAV | NN Sum: 4, NN D: .53, HMM Prob: .04 | GO:0016020 | membrane | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III000740ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III000740 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III001640 | BBOV_III001640-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1623 | BBOV_III001640 | aspartyl protease family protein | aspartyl protease family protein | 5479544 | A7AME7 | 3 | AAXT01000001:376,890..378,512(-) | AAXT01000001:376890..378512(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_107443 | 0 | 540 | 1623 | 61075 | 7.41 | 1 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III001640ORaspartyl protease family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III001640 OR aspartyl protease family protein AND Babesia bovis T2Bo |
|
BBOV_III001650 | BBOV_III001650-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 3222 | BBOV_III001650 | ubiquitin carboxyl-terminal hydrolase family protein | ubiquitin carboxyl-terminal hydrolase family protein | 5479545 | A7AME8 | 3 | AAXT01000001:380,116..383,337(+) | AAXT01000001:380116..383337(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_129339 | 0 | 1073 | 3222 | 120964 | 6.02 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III001650ORubiquitin carboxyl-terminal hydrolase family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III001650 OR ubiquitin carboxyl-terminal hydrolase family protein AND Babesia bovis T2Bo |
|
BBOV_III002280 | BBOV_III002280-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1299 | BBOV_III002280 | methionine aminopeptidase, type II family protein | methionine aminopeptidase, type II family protein | 5479608 | A7AML0 | 3 | AAXT01000001:534,747..536,152(-) | AAXT01000001:534747..536152(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_100815 | 0 | 432 | 1299 | 48188 | 6.12 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III002280ORmethionine aminopeptidase, type II family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III002280 OR methionine aminopeptidase, type II family protein AND Babesia bovis T2Bo |
|
BBOV_III002610 | BBOV_III002610-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1524 | BBOV_III002610 | peptidase family M3 containing protein | peptidase family M3 containing protein | 5479641 | A7AMP2 | 3 | AAXT01000001:604,427..606,142(+) | AAXT01000001:604427..606142(+) | AAXT01000001 | Babesia bovis T2Bo | 12 | OG6_102110 | 0 | 507 | 1524 | 57060 | 6.42 | 0 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.24.59 (Mitochondrial intermediate peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III002610ORpeptidase family M3 containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III002610 OR peptidase family M3 containing protein AND Babesia bovis T2Bo |
|
BBOV_III002870 | BBOV_III002870-t26_1 | 2 | 2 | 1 | 119 | | reverse | protein coding | No | 635 | BBOV_III002870 | signal peptidase family protein | signal peptidase family protein | 5479667 | A7AMR7 | 3 | AAXT01000001:653,803..654,475(-) | AAXT01000001:653922..654475(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_102447 | 0 | 171 | 516 | 19476 | 8.16 | 1 | HMM: MTAPAIRCYTVLSTSLFALWAALAL, NN: MTAPAIRCYTVLSTSLFALWAALAL | NN Sum: 4, NN D: .73, HMM Prob: .99 | GO:0016021;GO:0005787 | integral component of membrane;signal peptidase complex | GO:0008233 | peptidase activity | GO:0006465 | signal peptide processing | | | | | | | | 3.4.-.- (Acting on peptide bonds (peptidases).) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III002870ORsignal peptidase family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III002870 OR signal peptidase family protein AND Babesia bovis T2Bo |
|
BBOV_III003510 | BBOV_III003510-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1566 | BBOV_III003510 | eukaryotic aspartyl protease family protein | eukaryotic aspartyl protease family protein | 5479731 | A7AMY1 | 3 | AAXT01000001:783,622..785,288(+) | AAXT01000001:783622..785288(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_100536 | 0 | 521 | 1566 | 58507 | 5.07 | 0 | HMM: MKISVISVLSLVPAFYQHANAL, NN: MKISVISVLSLVPAFYQHANAL | NN Sum: 4, NN D: .61, HMM Prob: .95 | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III003510OReukaryotic aspartyl protease family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III003510 OR eukaryotic aspartyl protease family protein AND Babesia bovis T2Bo |
|
BBOV_III003800 | BBOV_III003800-t26_1 | 8 | 8 | 1 | | | forward | protein coding | No | 546 | BBOV_III003800 | SCP-like extracellular protein family protein | SCP-like extracellular protein family protein | 5479760 | A7AN09 | 3 | AAXT01000001:838,560..839,445(+) | AAXT01000001:838560..839445(+) | AAXT01000001 | Babesia bovis T2Bo | 6 | OG6_101367 | 0 | 181 | 546 | 20856 | 6.66 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III003800ORSCP-like extracellular protein family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III003800 OR SCP-like extracellular protein family protein AND Babesia bovis T2Bo |
|
BBOV_III003850 | BBOV_III003850-t26_1 | 1 | 1 | 1 | 76 | | forward | protein coding | No | 1567 | BBOV_III003850 | mitochondrial processing peptidase alpha subunit, putative | mitochondrial processing peptidase alpha subunit, putative | 5479765 | A7AN14 | 3 | AAXT01000001:846,287..847,853(+) | AAXT01000001:846287..847777(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_102381 | 0 | 496 | 1491 | 55599 | 6.37 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III003850ORmitochondrial processing peptidase alpha subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III003850 OR mitochondrial processing peptidase alpha subunit, putative AND Babesia bovis T2Bo |
|
BBOV_III004920 | BBOV_III004920-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 927 | BBOV_III004920 | exonuclease family protein | exonuclease family protein | 5479872 | A7ANC1 | 3 | AAXT01000001:1,049,017..1,050,025(+) | AAXT01000001:1049017..1050025(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_102772 | 1 | 308 | 927 | 34993 | 9.01 | 0 | | | | | | | | | | | | | | | | 3.1.13.4 (Poly(A)-specific ribonuclease) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III004920ORexonuclease family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III004920 OR exonuclease family protein AND Babesia bovis T2Bo |
|
BBOV_III005230 | BBOV_III005230-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 2394 | BBOV_III005230 | ATP-dependent metalloprotease FtsH family protein | ATP-dependent metalloprotease FtsH family protein | 5479903 | A7ANF2 | 3 | AAXT01000001:1,111,071..1,113,499(+) | AAXT01000001:1111071..1113499(+) | AAXT01000001 | Babesia bovis T2Bo | 14 | OG6_100384 | 0 | 797 | 2394 | 88163 | 7.71 | 0 | | | GO:0016021;GO:0016020 | integral component of membrane;membrane | GO:0005524;GO:0004222;GO:0008270 | ATP binding;metalloendopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III005230ORATP-dependent metalloprotease FtsH family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III005230 OR ATP-dependent metalloprotease FtsH family protein AND Babesia bovis T2Bo |
|
BBOV_III005950 | BBOV_III005950-t26_1 | 3 | 3 | 1 | | 196 | forward | protein coding | No | 577 | BBOV_III005950 | conserved hypothetical protein | conserved hypothetical protein | 5479975 | A7ANM2 | 3 | AAXT01000001:1,281,659..1,282,310(+) | AAXT01000001:1281855..1282310(+) | AAXT01000001 | Babesia bovis T2Bo | 8 | OG6_100707 | 0 | 126 | 381 | 14098 | 9.51 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III005950ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III005950 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III006020 | BBOV_III006020-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3369 | BBOV_III006020 | ATP-dependent protease La family protein | ATP-dependent protease La family protein | 5479982 | A7ANM9 | 3 | AAXT01000001:1,295,572..1,298,940(-) | AAXT01000001:1295572..1298940(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_100411 | 0 | 1122 | 3369 | 123525 | 6.09 | 0 | | | | | GO:0005524;GO:0004176;GO:0004252 | ATP binding;ATP-dependent peptidase activity;serine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III006020ORATP-dependent protease La family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III006020 OR ATP-dependent protease La family protein AND Babesia bovis T2Bo |
|
BBOV_III006090 | BBOV_III006090-t26_1 | 3 | 3 | 1 | | 111 | reverse | protein coding | No | 1374 | BBOV_III006090 | hypothetical protein | hypothetical protein | 5479989 | A7ANN6 | 3 | AAXT01000001:1,314,753..1,316,197(-) | AAXT01000001:1314753..1316086(-) | AAXT01000001 | Babesia bovis T2Bo | 10 | OG6_110414 | 0 | 420 | 1263 | 46435 | 8.53 | 0 | | | | | | | | | | | | | | | | 3.-.-.- (Hydrolases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III006090ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III006090 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III006120 | BBOV_III006120-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 3849 | BBOV_III006120 | beta-lactamase family protein | beta-lactamase family protein | 5479992 | A7ANN9 | 3 | AAXT01000001:1,320,042..1,323,916(+) | AAXT01000001:1320042..1323916(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_112296 | 0 | 1282 | 3849 | 143500 | 5.06 | 0 | | | | | | | | | | | | | | | | 1.14.13.- (With NADH or NADPH as one donor, and incorporation of one atom of oxygen.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III006120ORbeta-lactamase family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III006120 OR beta-lactamase family protein AND Babesia bovis T2Bo |
|
BBOV_III006180 | BBOV_III006180-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 2142 | BBOV_III006180 | ubiquitin carboxyl-terminal hydrolase family protein | ubiquitin carboxyl-terminal hydrolase family protein | 5479998 | A7ANP5 | 3 | AAXT01000001:1,335,209..1,337,350(+) | AAXT01000001:1335209..1337350(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_101457 | 0 | 713 | 2142 | 80453 | 8.86 | 0 | | | | | GO:0036459 | thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III006180ORubiquitin carboxyl-terminal hydrolase family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III006180 OR ubiquitin carboxyl-terminal hydrolase family protein AND Babesia bovis T2Bo |
|
BBOV_III007090 | BBOV_III007090-t26_1 | 3 | 3 | 1 | | 100 | forward | protein coding | No | 718 | BBOV_III007090 | proteasome A-type and B-type family protein | proteasome A-type and B-type family protein | 5480089 | A7ANY6 | 3 | AAXT01000001:1,536,356..1,537,345(+) | AAXT01000001:1536456..1537345(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_101970 | 0 | 205 | 618 | 22416 | 5.64 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III007090ORproteasome A-type and B-type family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III007090 OR proteasome A-type and B-type family protein AND Babesia bovis T2Bo |
|
BBOV_III007670 | BBOV_III007670-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 2685 | BBOV_III007670 | calpain family cysteine protease domain containing protein | calpain family cysteine protease domain containing protein | 5480147 | A7AP43 | 3 | AAXT01000001:1,661,418..1,664,102(-) | AAXT01000001:1661418..1664102(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_103851 | 0 | 894 | 2685 | 99567 | 7.26 | 0 | | | GO:0005622 | intracellular | GO:0004198 | calcium-dependent cysteine-type endopeptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III007670ORcalpain family cysteine protease domain containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III007670 OR calpain family cysteine protease domain containing protein AND Babesia bovis T2Bo |
|
BBOV_III007870 | BBOV_III007870-t26_1 | 1 | 1 | 1 | | 99 | reverse | protein coding | No | 813 | BBOV_III007870 | conserved hypothetical protein | conserved hypothetical protein | 5480167 | A7AP63 | 3 | AAXT01000001:1,707,764..1,708,576(-) | AAXT01000001:1707764..1708477(-) | AAXT01000001 | Babesia bovis T2Bo | 25 | OG6_100915 | 2 | 237 | 714 | 26969 | 6.03 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III007870ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III007870 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III007880 | BBOV_III007880-t26_1 | 1 | 1 | 1 | 3 | | reverse | protein coding | No | 3423 | BBOV_III007880 | hypothetical protein | hypothetical protein | 5480168 | A7AP64 | 3 | AAXT01000001:1,709,002..1,712,424(-) | AAXT01000001:1709005..1712424(-) | AAXT01000001 | Babesia bovis T2Bo | 25 | OG6_100915 | 2 | 1139 | 3420 | 130707 | 6.87 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III007880ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III007880 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III008370 | BBOV_III008370-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1875 | BBOV_III008370 | metallopeptidase M24 family protein | metallopeptidase M24 family protein | 5480217 | A7APB3 | 3 | AAXT01000001:1,804,609..1,806,620(-) | AAXT01000001:1804609..1806620(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_100896 | 0 | 624 | 1875 | 70286 | 5.85 | 0 | | | | | GO:0016787 | hydrolase activity | | | | | | | | | | 3.4.11.9 (Xaa-Pro aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III008370ORmetallopeptidase M24 family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III008370 OR metallopeptidase M24 family protein AND Babesia bovis T2Bo |
|
BBOV_III008600 | BBOV_III008600-t26_1 | 1 | 1 | 1 | | 181 | forward | protein coding | No | 970 | BBOV_III008600 | Der1-like family protein | Der1-like family protein | 5480240 | A7APD6 | 3 | AAXT01000001:1,857,348..1,858,317(+) | AAXT01000001:1857529..1858317(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_113960 | 0 | 262 | 789 | 30530 | 9.75 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III008600ORDer1-like family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III008600 OR Der1-like family protein AND Babesia bovis T2Bo |
|
BBOV_III008630 | BBOV_III008630-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1491 | BBOV_III008630 | ubiquitin carboxyl-terminal hydrolase family protein | ubiquitin carboxyl-terminal hydrolase family protein | 5480243 | A7APD9 | 3 | AAXT01000001:1,863,144..1,864,704(-) | AAXT01000001:1863144..1864704(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_101892 | 0 | 496 | 1491 | 56041 | 4.87 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III008630ORubiquitin carboxyl-terminal hydrolase family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III008630 OR ubiquitin carboxyl-terminal hydrolase family protein AND Babesia bovis T2Bo |
|
BBOV_III008650 | BBOV_III008650-t26_1 | 3 | 3 | 1 | | 20 | reverse | protein coding | No | 1013 | BBOV_III008650 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 5480245 | A7APE1 | 3 | AAXT01000001:1,866,770..1,868,163(-) | AAXT01000001:1866770..1868143(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_124490 | 0 | 330 | 993 | 36037 | 6.81 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III008650ORmethionine aminopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III008650 OR methionine aminopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_III008980 | BBOV_III008980-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3018 | BBOV_III008980 | Clp amino terminal domain containing protein | Clp amino terminal domain containing protein | 5480278 | A7APH1 | 3 | AAXT01000001:1,938,961..1,942,012(-) | AAXT01000001:1938961..1942012(-) | AAXT01000001 | Babesia bovis T2Bo | 27 | OG6_100223 | 4 | 1005 | 3018 | 112897 | 6.64 | 0 | | | | | GO:0005524 | ATP binding | GO:0019538 | protein metabolic process | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III008980ORClp amino terminal domain containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III008980 OR Clp amino terminal domain containing protein AND Babesia bovis T2Bo |
|
BBOV_III009030 | BBOV_III009030-t26_1 | 6 | 6 | 1 | 72 | | reverse | protein coding | No | 2106 | BBOV_III009030 | protein of unknown function (DUF1671) protein family | protein of unknown function (DUF1671) protein family | 5480283 | A7APH6 | 3 | AAXT01000001:1,948,134..1,950,468(-) | AAXT01000001:1948206..1950468(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_102601 | 0 | 677 | 2034 | 75813 | 5.01 | 1 | HMM: MVLQCSLSLFSSSKGE, NN: MVLQCSLSLFSSSKGE | NN Sum: 1, NN D: .21, HMM Prob: .61 | | | | | | | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III009030ORprotein of unknown function (DUF1671) protein familyANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III009030 OR protein of unknown function (DUF1671) protein family AND Babesia bovis T2Bo |
|
BBOV_III009190 | BBOV_III009190-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 774 | BBOV_III009190 | proteasome A-type and B-type family protein | proteasome A-type and B-type family protein | 5480299 | Q2PKF6 | 3 | AAXT01000001:1,984,338..1,985,111(-) | AAXT01000001:1984338..1985111(-) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_101968 | 0 | 257 | 774 | 28385 | 5.89 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III009190ORproteasome A-type and B-type family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III009190 OR proteasome A-type and B-type family protein AND Babesia bovis T2Bo |
|
BBOV_III009200 | BBOV_III009200-t26_1 | 5 | 5 | 1 | 111 | 6 | forward | protein coding | No | 828 | BBOV_III009200 | proteasome A-type and B-type family protein | proteasome A-type and B-type family protein | 5480300 | A7APJ3 | 3 | AAXT01000001:1,985,370..1,986,340(+) | AAXT01000001:1985376..1986229(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_101207 | 0 | 236 | 711 | 25813 | 8.95 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III009200ORproteasome A-type and B-type family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III009200 OR proteasome A-type and B-type family protein AND Babesia bovis T2Bo |
|
BBOV_III009430 | BBOV_III009430-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1221 | BBOV_III009430 | glycoprotease family protein | glycoprotease family protein | 5480323 | A7APL5 | 3 | AAXT01000001:2,018,666..2,020,053(+) | AAXT01000001:2018666..2020053(+) | AAXT01000001 | Babesia bovis T2Bo | 19 | OG6_100288 | 1 | 406 | 1221 | 45268 | 6.63 | 0 | | | | | | | | | | | | | | | | 2.3.1.234 (N(6)-L-threonylcarbamoyladenine synthase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III009430ORglycoprotease family proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III009430 OR glycoprotease family protein AND Babesia bovis T2Bo |
|
BBOV_III009770 | BBOV_III009770-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 480 | BBOV_III009770 | hypothetical protein | hypothetical protein | 5480357 | A7APP9 | 3 | AAXT01000001:2,094,998..2,095,545(+) | AAXT01000001:2094998..2095545(+) | AAXT01000001 | Babesia bovis T2Bo | 8 | OG6_102074 | 0 | 159 | 480 | 17594 | 6.09 | 1 | | | | | GO:0046872 | metal ion binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III009770ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III009770 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III010070 | BBOV_III010070-t26_1 | 1 | 1 | 1 | | 16 | forward | protein coding | No | 1324 | BBOV_III010070 | papain family cysteine protease containing protein | papain family cysteine protease containing protein | 5480387 | A7APS9 | 3 | AAXT01000001:2,166,068..2,167,391(+) | AAXT01000001:2166084..2167391(+) | AAXT01000001 | Babesia bovis T2Bo | 40 | OG6_100116 | 1 | 435 | 1308 | 49106 | 5.32 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III010070ORpapain family cysteine protease containing proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III010070 OR papain family cysteine protease containing protein AND Babesia bovis T2Bo |
|
BBOV_III010190 | BBOV_III010190-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 1503 | BBOV_III010190 | conserved hypothetical protein | conserved hypothetical protein | 5480399 | A7APU1 | 3 | AAXT01000001:2,192,008..2,193,679(+) | AAXT01000001:2192008..2193679(+) | AAXT01000001 | Babesia bovis T2Bo | 6 | OG6_101685 | 0 | 500 | 1503 | 56558 | 5.52 | 0 | | | | | GO:0004190;GO:0005515 | aspartic-type endopeptidase activity;protein binding | GO:0006508 | proteolysis | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III010190ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III010190 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III010270 | BBOV_III010270-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 252 | BBOV_III010270 | hypothetical protein | hypothetical protein | 5480407 | A7APU9 | 3 | AAXT01000001:2,209,377..2,209,664(+) | AAXT01000001:2209377..2209664(+) | AAXT01000001 | Babesia bovis T2Bo | 8 | OG6_101672 | 0 | 83 | 252 | 9523 | 8.88 | 1 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III010270ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III010270 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_III010630 | BBOV_III010630-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 828 | BBOV_III010630 | ubiquitin carboxyl-terminal hydrolase, family 1 protein | ubiquitin carboxyl-terminal hydrolase, family 1 protein | 5480443 | A7APY2 | 3 | AAXT01000001:2,274,792..2,276,054(+) | AAXT01000001:2274792..2276054(+) | AAXT01000001 | Babesia bovis T2Bo | 3 | OG6_101218 | 0 | 275 | 828 | 31045 | 5.22 | 0 | | | GO:0005622 | intracellular | GO:0004843 | thiol-dependent ubiquitin-specific protease activity | GO:0006511 | ubiquitin-dependent protein catabolic process | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III010630ORubiquitin carboxyl-terminal hydrolase, family 1 proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III010630 OR ubiquitin carboxyl-terminal hydrolase, family 1 protein AND Babesia bovis T2Bo |
|
BBOV_III011220 | BBOV_III011220-t26_1 | 5 | 5 | 1 | | | forward | protein coding | No | 423 | BBOV_III011220 | hypothetical protein | hypothetical protein | 5480502 | A7AQ40 | 3 | AAXT01000001:2,400,917..2,401,536(+) | AAXT01000001:2400917..2401536(+) | AAXT01000001 | Babesia bovis T2Bo | 9 | OG6_102788 | 0 | 140 | 423 | 15987 | 7.41 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_III011220ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_III011220 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV000300 | BBOV_IV000300-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 831 | BBOV_IV000300 | Der1-like family, putative | Der1-like family, putative | 5477417 | A7AV04 | Not Assigned | AAXT01000004:78,900..79,730(+) | AAXT01000004:78900..79730(+) | AAXT01000004 | Babesia bovis T2Bo | 14 | OG6_130104 | 1 | 276 | 831 | 31802 | 8.76 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV000300ORDer1-like family, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV000300 OR Der1-like family, putative AND Babesia bovis T2Bo |
|
BBOV_IV000310 | BBOV_IV000310-t26_1 | 3 | 3 | 1 | | 7 | reverse | protein coding | No | 1354 | BBOV_IV000310 | CAAX metallo endopeptidase, putative | CAAX metallo endopeptidase, putative | 5477418 | A7AV05 | Not Assigned | AAXT01000004:80,954..82,378(-) | AAXT01000004:80954..82371(-) | AAXT01000004 | Babesia bovis T2Bo | 12 | OG6_101632 | 0 | 448 | 1347 | 52653 | 8.87 | 5 | | | | | GO:0004222 | metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.84 (Ste24 endopeptidase) | 3.4.24.84 (Ste24 endopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV000310ORCAAX metallo endopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV000310 OR CAAX metallo endopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_IV000320 | BBOV_IV000320-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 774 | BBOV_IV000320 | proteasome subunit alpha type 1 | proteasome subunit alpha type 1 | 5477419 | A7AV06 | Not Assigned | AAXT01000004:82,583..83,498(-) | AAXT01000004:82583..83498(-) | AAXT01000004 | Babesia bovis T2Bo | 10 | OG6_102143 | 0 | 257 | 774 | 28882 | 7.57 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV000320ORproteasome subunit alpha type 1ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV000320 OR proteasome subunit alpha type 1 AND Babesia bovis T2Bo |
|
BBOV_IV001260 | BBOV_IV001260-t26_1 | 5 | 5 | 1 | | 60 | forward | protein coding | No | 1605 | BBOV_IV001260 | mitochondrial processing peptidase beta subunit | mitochondrial processing peptidase beta subunit | 5477510 | A7AV97 | Not Assigned | AAXT01000004:288,536..290,283(+) | AAXT01000004:288596..290283(+) | AAXT01000004 | Babesia bovis T2Bo | 9 | OG6_100777 | 0 | 514 | 1545 | 57886 | 6.35 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.64 (Mitochondrial processing peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV001260ORmitochondrial processing peptidase beta subunitANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV001260 OR mitochondrial processing peptidase beta subunit AND Babesia bovis T2Bo |
|
BBOV_IV001730 | BBOV_IV001730-t26_1 | 1 | 1 | 1 | 42 | | reverse | protein coding | No | 4383 | BBOV_IV001730 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5477557 | A7AVE4 | Not Assigned | AAXT01000004:392,203..396,585(-) | AAXT01000004:392245..396585(-) | AAXT01000004 | Babesia bovis T2Bo | 10 | OG6_101317 | 0 | 1446 | 4341 | 164464 | 5.26 | 0 | | | | | GO:0005515;GO:0036459 | protein binding;thiol-dependent ubiquitinyl hydrolase activity | GO:0016579 | protein deubiquitination | | | | | | | | 3.1.2.15 (Deleted entry) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV001730ORubiquitin carboxyl-terminal hydrolase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV001730 OR ubiquitin carboxyl-terminal hydrolase, putative AND Babesia bovis T2Bo |
|
BBOV_IV001950 | BBOV_IV001950-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1836 | BBOV_IV001950 | methionine aminopeptidase I, putative | methionine aminopeptidase I, putative | 5477579 | A7AVG6 | Not Assigned | AAXT01000004:456,764..458,735(-) | AAXT01000004:456764..458735(-) | AAXT01000004 | Babesia bovis T2Bo | 9 | OG6_171502 | 0 | 611 | 1836 | 69382 | 7.67 | 0 | HMM: MILPFVALVAALSTYNAN, NN: MILPFVALVAALSTYNAN | NN Sum: 4, NN D: .65, HMM Prob: .87 | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV001950ORmethionine aminopeptidase I, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV001950 OR methionine aminopeptidase I, putative AND Babesia bovis T2Bo |
|
BBOV_IV002030 | BBOV_IV002030-t26_1 | 3 | 3 | 1 | | 5 | reverse | protein coding | No | 2189 | BBOV_IV002030 | conserved hypothetical protein | conserved hypothetical protein | 5477587 | A7AVH4 | Not Assigned | AAXT01000004:472,011..474,267(-) | AAXT01000004:472011..474262(-) | AAXT01000004 | Babesia bovis T2Bo | 9 | OG6_102131 | 0 | 727 | 2184 | 80225 | 5.25 | 0 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV002030ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV002030 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV002060 | BBOV_IV002060-t26_1 | 3 | 3 | 1 | 28 | 80 | forward | protein coding | No | 789 | BBOV_IV002060 | proteasome subunit beta type 4 | proteasome subunit beta type 4 | 5477590 | A7AVH7 | Not Assigned | AAXT01000004:477,689..478,574(+) | AAXT01000004:477769..478546(+) | AAXT01000004 | Babesia bovis T2Bo | 9 | OG6_101718 | 0 | 226 | 681 | 25569 | 8.20 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV002060ORproteasome subunit beta type 4ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV002060 OR proteasome subunit beta type 4 AND Babesia bovis T2Bo |
|
BBOV_IV003800 | BBOV_IV003800-t26_1 | 1 | 1 | 1 | 56 | | reverse | protein coding | No | 659 | BBOV_IV003800 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 5478568 | A7AQC2 | Not Assigned | AAXT01000002:9,509..10,167(-) | AAXT01000002:9565..10167(-) | AAXT01000002 | Babesia bovis T2Bo | 15 | OG6_100939 | 2 | 200 | 603 | 22312 | 7.66 | 0 | | | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV003800ORATP-dependent Clp protease proteolytic subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV003800 OR ATP-dependent Clp protease proteolytic subunit, putative AND Babesia bovis T2Bo |
|
BBOV_IV003850 | BBOV_IV003850-t26_1 | 2 | 2 | 1 | | 94 | reverse | protein coding | No | 832 | BBOV_IV003850 | ATP-dependent Clp protease proteolytic subunit, putative | ATP-dependent Clp protease proteolytic subunit, putative | 5478573 | A7AQC7 | Not Assigned | AAXT01000002:16,493..17,426(-) | AAXT01000002:16493..17332(-) | AAXT01000002 | Babesia bovis T2Bo | 15 | OG6_100939 | 2 | 245 | 738 | 27592 | 8.83 | 1 | HMM: MATMHCITGILTIIVLLQGFIATF, NN: MATMHCITGILTIIVLLQGFIATF | NN Sum: 3, NN D: .69, HMM Prob: .55 | | | | | | | | | | | | | 3.4.21.92 (Endopeptidase Clp) | 3.4.21.92 (Endopeptidase Clp) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV003850ORATP-dependent Clp protease proteolytic subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV003850 OR ATP-dependent Clp protease proteolytic subunit, putative AND Babesia bovis T2Bo |
|
BBOV_IV004330 | BBOV_IV004330-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1611 | BBOV_IV004330 | DegP protease, putative | DegP protease, putative | 5478596 | A7AQH5 | Not Assigned | AAXT01000002:128,989..130,811(+) | AAXT01000002:128989..130811(+) | AAXT01000002 | Babesia bovis T2Bo | 10 | OG6_105727 | 0 | 536 | 1611 | 59909 | 6.72 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 3.4.21.108 (HtrA2 peptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV004330ORDegP protease, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV004330 OR DegP protease, putative AND Babesia bovis T2Bo |
|
BBOV_IV004350 | BBOV_IV004350-t26_1 | 7 | 7 | 1 | | | reverse | protein coding | No | 2373 | BBOV_IV004350 | ubiquitin carboxyl-terminal hydrolase, putative | ubiquitin carboxyl-terminal hydrolase, putative | 5478598 | A7AQH7 | Not Assigned | AAXT01000002:131,993..134,646(-) | AAXT01000002:131993..134646(-) | AAXT01000002 | Babesia bovis T2Bo | 10 | OG6_101380 | 0 | 790 | 2373 | 88354 | 4.65 | 0 | | | | | GO:0005515;GO:0004843;GO:0036459;GO:0008270 | protein binding;thiol-dependent ubiquitin-specific protease activity;thiol-dependent ubiquitinyl hydrolase activity;zinc ion binding | GO:0016579 | protein deubiquitination | | | | | | | 3.1.2.15 (Deleted entry);3.4.19.12 (Ubiquitinyl hydrolase 1) | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV004350ORubiquitin carboxyl-terminal hydrolase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV004350 OR ubiquitin carboxyl-terminal hydrolase, putative AND Babesia bovis T2Bo |
|
BBOV_IV004580 | BBOV_IV004580-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 1257 | BBOV_IV004580 | 26S protease regulatory subunit 6A, putative | 26S protease regulatory subunit 6A, putative | 5478621 | A7AQK0 | Not Assigned | AAXT01000002:172,282..173,607(-) | AAXT01000002:172282..173607(-) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_101915 | 0 | 418 | 1257 | 46565 | 5.87 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV004580OR26S protease regulatory subunit 6A, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV004580 OR 26S protease regulatory subunit 6A, putative AND Babesia bovis T2Bo |
|
BBOV_IV005570 | BBOV_IV005570-t26_1 | 4 | 4 | 1 | | 31 | forward | protein coding | No | 1201 | BBOV_IV005570 | proliferation-associated protein 2g4, putative | proliferation-associated protein 2g4, putative | 5478720 | A7AQU9 | Not Assigned | AAXT01000002:392,021..393,453(+) | AAXT01000002:392214..393453(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_101895 | 0 | 389 | 1170 | 42286 | 7.95 | 0 | | | | | | | | | | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV005570ORproliferation-associated protein 2g4, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV005570 OR proliferation-associated protein 2g4, putative AND Babesia bovis T2Bo |
|
BBOV_IV005590 | BBOV_IV005590-t26_1 | 4 | 4 | 1 | | | forward | protein coding | No | 1434 | BBOV_IV005590 | hypothetical protein | hypothetical protein | 5478722 | A7AQV1 | Not Assigned | AAXT01000002:395,180..396,735(+) | AAXT01000002:395180..396735(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_187187 | 0 | 477 | 1434 | 55558 | 10.08 | 0 | | | | | GO:0003677 | DNA binding | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV005590ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV005590 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV005690 | BBOV_IV005690-t26_1 | 3 | 3 | 1 | | | reverse | protein coding | No | 648 | BBOV_IV005690 | hypothetical protein | hypothetical protein | 5478732 | A7AQW1 | Not Assigned | AAXT01000002:423,381..424,177(-) | AAXT01000002:423381..424177(-) | AAXT01000002 | Babesia bovis T2Bo | 25 | OG6_100915 | 2 | 215 | 648 | 23859 | 7.57 | 0 | | | | | | | | | | | | | | | | 3.1.1.23 (Acylglycerol lipase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV005690ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV005690 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV005790 | BBOV_IV005790-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1395 | BBOV_IV005790 | rhomboid-like peptidase, putative | rhomboid-like peptidase, putative | 5478742 | A7AQX1 | Not Assigned | AAXT01000002:440,575..441,969(-) | AAXT01000002:440575..441969(-) | AAXT01000002 | Babesia bovis T2Bo | 11 | OG6_146128 | 1 | 464 | 1395 | 52781 | 6.01 | 6 | | | GO:0016021 | integral component of membrane | GO:0004252 | serine-type endopeptidase activity | | | | | | | | | 3.4.21.- (Serine endopeptidases.) | 3.4.21.- (Serine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV005790ORrhomboid-like peptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV005790 OR rhomboid-like peptidase, putative AND Babesia bovis T2Bo |
|
BBOV_IV005930 | BBOV_IV005930-t26_1 | 2 | 2 | 1 | | | forward | protein coding | No | 2541 | BBOV_IV005930 | aminopeptidase, putative | aminopeptidase, putative | 5478756 | A7AQY5 | Not Assigned | AAXT01000002:472,477..475,179(+) | AAXT01000002:472477..475179(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_106799 | 0 | 846 | 2541 | 95941 | 5.75 | 0 | | | | | GO:0008237;GO:0008270 | metallopeptidase activity;zinc ion binding | | | | | | | | | 3.4.11.2 (Membrane alanyl aminopeptidase) | 3.4.11.2 (Membrane alanyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV005930ORaminopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV005930 OR aminopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_IV006720 | BBOV_IV006720-t26_1 | 5 | 5 | 1 | | | reverse | protein coding | No | 1155 | BBOV_IV006720 | conserved hypothetical protein | conserved hypothetical protein | 5478830 | A7AR59 | Not Assigned | AAXT01000002:646,979..648,412(-) | AAXT01000002:646979..648412(-) | AAXT01000002 | Babesia bovis T2Bo | 10 | OG6_101256 | 0 | 384 | 1155 | 42581 | 10.18 | 0 | | | | | | | | | | | | | | | | 3.4.19.12 (Ubiquitinyl hydrolase 1) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV006720ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV006720 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV006760 | BBOV_IV006760-t26_1 | 9 | 9 | 1 | | | forward | protein coding | No | 1131 | BBOV_IV006760 | methionine aminopeptidase, putative | methionine aminopeptidase, putative | 5478834 | A7AR63 | Not Assigned | AAXT01000002:652,995..654,760(+) | AAXT01000002:652995..654760(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_100342 | 0 | 376 | 1131 | 41663 | 7.48 | 0 | | | | | GO:0004177;GO:0008235 | aminopeptidase activity;metalloexopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.11.18 (Methionyl aminopeptidase) | 3.4.11.18 (Methionyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV006760ORmethionine aminopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV006760 OR methionine aminopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_IV007270 | BBOV_IV007270-t26_1 | 2 | 2 | 1 | | | reverse | protein coding | No | 3507 | BBOV_IV007270 | hypothetical protein | hypothetical protein | 5478885 | A7ARB4 | Not Assigned | AAXT01000002:757,586..761,126(-) | AAXT01000002:757586..761126(-) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_113142 | 0 | 1168 | 3507 | 131351 | 5.01 | 4 | | | | | | | | | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV007270ORhypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV007270 OR hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV007650 | BBOV_IV007650-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1326 | BBOV_IV007650 | conserved hypothetical protein | conserved hypothetical protein | 5478921 | A7ARF0 | Not Assigned | AAXT01000002:838,000..839,431(-) | AAXT01000002:838000..839431(-) | AAXT01000002 | Babesia bovis T2Bo | 10 | OG6_134153 | 0 | 441 | 1326 | 51214 | 8.00 | 0 | | | | | GO:0003860 | 3-hydroxyisobutyryl-CoA hydrolase activity | | | | | | | | | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | 3.1.2.4 (3-hydroxyisobutyryl-CoA hydrolase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV007650ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV007650 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV007730 | BBOV_IV007730-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1338 | BBOV_IV007730 | cysteine protease 2 | cysteine protease 2 | 5478929 | A7ARF8 | Not Assigned | AAXT01000002:850,162..851,499(+) | AAXT01000002:850162..851499(+) | AAXT01000002 | Babesia bovis T2Bo | 40 | OG6_100116 | 1 | 445 | 1338 | 49327 | 7.37 | 1 | | | | | GO:0008234 | cysteine-type peptidase activity | GO:0006508 | proteolysis | | | | | | | | 3.4.22.- (Cysteine endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV007730ORcysteine protease 2ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV007730 OR cysteine protease 2 AND Babesia bovis T2Bo |
|
BBOV_IV007800 | BBOV_IV007800-t26_1 | 2 | 2 | 1 | 132 | | reverse | protein coding | No | 912 | BBOV_IV007800 | proteasome subunit alpha, putative | proteasome subunit alpha, putative | 5478936 | A7ARG5 | Not Assigned | AAXT01000002:868,399..869,480(-) | AAXT01000002:868531..869480(-) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_102011 | 0 | 259 | 780 | 27909 | 5.57 | 0 | | | GO:0005839;GO:0019773 | proteasome core complex;proteasome core complex, alpha-subunit complex | GO:0004175;GO:0004298 | endopeptidase activity;threonine-type endopeptidase activity | GO:0051603;GO:0006511 | proteolysis involved in cellular protein catabolic process;ubiquitin-dependent protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV007800ORproteasome subunit alpha, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV007800 OR proteasome subunit alpha, putative AND Babesia bovis T2Bo |
|
BBOV_IV007890 | BBOV_IV007890-t26_1 | 9 | 9 | 1 | | 505 | reverse | protein coding | No | 1897 | BBOV_IV007890 | aspartyl protease, putative | aspartyl protease, putative | 5478945 | A7ARH4 | Not Assigned | AAXT01000002:885,265..887,572(-) | AAXT01000002:885265..887067(-) | AAXT01000002 | Babesia bovis T2Bo | 20 | OG6_119797 | 1 | 463 | 1392 | 52175 | 7.11 | 0 | HMM: MNIWNVKYIAGTTAIWLVSRYAKAD, NN: MNIWNVKYIAGTTAIWLVSRYAKAD | NN Sum: 4, NN D: .5, HMM Prob: .19 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV007890ORaspartyl protease, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV007890 OR aspartyl protease, putative AND Babesia bovis T2Bo |
|
BBOV_IV008660 | BBOV_IV008660-t26_1 | 3 | 3 | 1 | | 21 | forward | protein coding | No | 837 | BBOV_IV008660 | proteasome subunit beta 7, putative | proteasome subunit beta 7, putative | 5479022 | A7ARQ1 | Not Assigned | AAXT01000002:1,052,890..1,053,967(+) | AAXT01000002:1052911..1053967(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_101382 | 0 | 271 | 816 | 29359 | 7.76 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV008660ORproteasome subunit beta 7, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV008660 OR proteasome subunit beta 7, putative AND Babesia bovis T2Bo |
|
BBOV_IV009000 | BBOV_IV009000-t26_1 | 4 | 4 | 1 | 258 | 73 | forward | protein coding | No | 1138 | BBOV_IV009000 | proteasome epsilon subunit, putative | proteasome epsilon subunit, putative | 5479056 | A7ART5 | Not Assigned | AAXT01000002:1,118,118..1,119,416(+) | AAXT01000002:1118191..1119158(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_100897 | 0 | 268 | 807 | 29881 | 6.72 | 0 | | | GO:0005839 | proteasome core complex | GO:0004298 | threonine-type endopeptidase activity | GO:0051603 | proteolysis involved in cellular protein catabolic process | | | | | | | 3.4.25.1 (Proteasome endopeptidase complex) | 3.4.25.1 (Proteasome endopeptidase complex) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV009000ORproteasome epsilon subunit, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV009000 OR proteasome epsilon subunit, putative AND Babesia bovis T2Bo |
|
BBOV_IV009290 | BBOV_IV009290-t26_1 | 4 | 4 | 1 | | | reverse | protein coding | No | 1317 | BBOV_IV009290 | 26S protease regulatory subunit 4, putative | 26S protease regulatory subunit 4, putative | 5479085 | A7ARW4 | Not Assigned | AAXT01000002:1,177,667..1,179,319(-) | AAXT01000002:1177667..1179319(-) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_101477 | 0 | 438 | 1317 | 49086 | 5.87 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV009290OR26S protease regulatory subunit 4, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV009290 OR 26S protease regulatory subunit 4, putative AND Babesia bovis T2Bo |
|
BBOV_IV009660 | BBOV_IV009660-t26_1 | 6 | 6 | 1 | | | reverse | protein coding | No | 1308 | BBOV_IV009660 | aspartyl protease, putative | aspartyl protease, putative | 5479122 | A7AS01 | Not Assigned | AAXT01000002:1,269,306..1,271,035(-) | AAXT01000002:1269306..1271035(-) | AAXT01000002 | Babesia bovis T2Bo | 10 | OG6_139465 | 0 | 435 | 1308 | 48863 | 4.39 | 0 | | | | | | | | | | | | | | | | 3.4.23.- (Aspartic endopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV009660ORaspartyl protease, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV009660 OR aspartyl protease, putative AND Babesia bovis T2Bo |
|
BBOV_IV009940 | BBOV_IV009940-t26_1 | 7 | 7 | 1 | 25 | | forward | protein coding | No | 1303 | BBOV_IV009940 | 26S protease regulatory subunit 7, putative | 26S protease regulatory subunit 7, putative | 5479150 | A7AS29 | Not Assigned | AAXT01000002:1,324,774..1,326,439(+) | AAXT01000002:1324774..1326414(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_101899 | 0 | 425 | 1278 | 47015 | 7.39 | 0 | | | GO:0005737 | cytoplasm | GO:0005524;GO:0016787 | ATP binding;hydrolase activity | GO:0030163 | protein catabolic process | | | | | | | | 3.6.4.8 (Transferred entry: 5.6.1.5) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV009940OR26S protease regulatory subunit 7, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV009940 OR 26S protease regulatory subunit 7, putative AND Babesia bovis T2Bo |
|
BBOV_IV010360 | BBOV_IV010360-t26_1 | 3 | 3 | 1 | | 13 | reverse | protein coding | No | 1612 | BBOV_IV010360 | aspartyl protease, putative | aspartyl protease, putative | 5479191 | A7AS70 | Not Assigned | AAXT01000002:1,413,759..1,415,460(-) | AAXT01000002:1413759..1415447(-) | AAXT01000002 | Babesia bovis T2Bo | 20 | OG6_119797 | 1 | 532 | 1599 | 58573 | 7.90 | 0 | HMM: MVIATLIAAIVWQACISK, NN: MVIATLIAAIVWQACISKICYPAWVLSVVDAA | NN Sum: 4, NN D: .58, HMM Prob: .96 | | | | | | | | | | | | | | 3.4.23.1 (Pepsin A) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV010360ORaspartyl protease, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV010360 OR aspartyl protease, putative AND Babesia bovis T2Bo |
|
BBOV_IV010560 | BBOV_IV010560-t26_1 | 1 | 1 | 1 | | 136 | reverse | protein coding | No | 1291 | BBOV_IV010560 | lysophospholipase, putative | lysophospholipase, putative | 5479211 | A7AS90 | Not Assigned | AAXT01000002:1,450,382..1,451,672(-) | AAXT01000002:1450382..1451536(-) | AAXT01000002 | Babesia bovis T2Bo | 183 | OG6_100231 | 0 | 384 | 1155 | 43214 | 7.84 | 0 | | | | | | | | | | | | | | | | 3.1.1.5 (Lysophospholipase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV010560ORlysophospholipase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV010560 OR lysophospholipase, putative AND Babesia bovis T2Bo |
|
BBOV_IV010700 | BBOV_IV010700-t26_1 | 3 | 3 | 1 | | | forward | protein coding | No | 594 | BBOV_IV010700 | ubiquitin-conjugating enzyme, putative | ubiquitin-conjugating enzyme, putative | 5479225 | A7ASA4 | Not Assigned | AAXT01000002:1,479,983..1,480,647(+) | AAXT01000002:1479983..1480647(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_103192 | 0 | 197 | 594 | 22412 | 4.47 | 0 | | | | | GO:0005515 | protein binding | | | | | | | | | | 6.3.2.19 (Transferred entry: 2.3.2.23, 2.3.2.27 and 6.2.1.45) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV010700ORubiquitin-conjugating enzyme, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV010700 OR ubiquitin-conjugating enzyme, putative AND Babesia bovis T2Bo |
|
BBOV_IV010870 | BBOV_IV010870-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 3330 | BBOV_IV010870 | conserved hypothetical protein | conserved hypothetical protein | 5479242 | A7ASC1 | Not Assigned | AAXT01000002:1,509,803..1,513,132(-) | AAXT01000002:1509803..1513132(-) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_105738 | 0 | 1109 | 3330 | 123405 | 4.77 | 0 | | | | | GO:0003824;GO:0046872 | catalytic activity;metal ion binding | | | | | | | | | | 3.4.24.56 (Insulysin) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV010870ORconserved hypothetical proteinANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV010870 OR conserved hypothetical protein AND Babesia bovis T2Bo |
|
BBOV_IV011230 | BBOV_IV011230-t26_1 | 1 | 1 | 1 | 208 | 246 | forward | protein coding | No | 2272 | BBOV_IV011230 | apical membrane antigen 1 | apical membrane antigen 1 | 5479277 | A7ASF6 | Not Assigned | AAXT01000002:1,592,274..1,594,545(+) | AAXT01000002:1592520..1594337(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_130922 | 0 | 605 | 1818 | 67303 | 6.69 | 2 | | | GO:0016020 | membrane | | | GO:0009405 | pathogenesis | | | | | | | | | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV011230ORapical membrane antigen 1ANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV011230 OR apical membrane antigen 1 AND Babesia bovis T2Bo |
|
BBOV_IV011550 | BBOV_IV011550-t26_1 | 6 | 6 | 1 | | | forward | protein coding | No | 1290 | BBOV_IV011550 | aspartyl aminopeptidase, putative | aspartyl aminopeptidase, putative | 5479309 | A7ASI8 | Not Assigned | AAXT01000002:1,668,712..1,670,308(+) | AAXT01000002:1668712..1670308(+) | AAXT01000002 | Babesia bovis T2Bo | 9 | OG6_102047 | 0 | 429 | 1290 | 48018 | 6.64 | 0 | | | | | GO:0004177;GO:0008270 | aminopeptidase activity;zinc ion binding | GO:0006508 | proteolysis | | | | | | | 3.4.11.21 (Aspartyl aminopeptidase) | 3.4.11.21 (Aspartyl aminopeptidase) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV011550ORaspartyl aminopeptidase, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV011550 OR aspartyl aminopeptidase, putative AND Babesia bovis T2Bo |
|
BBOV_IV011870 | BBOV_IV011870-t26_1 | 1 | 1 | 1 | | | forward | protein coding | No | 1977 | BBOV_IV011870 | cell division protein metalloprotease FtsH, putative | cell division protein metalloprotease FtsH, putative | 5479341 | A7ASM0 | Not Assigned | AAXT01000002:1,734,070..1,736,046(+) | AAXT01000002:1734070..1736046(+) | AAXT01000002 | Babesia bovis T2Bo | 13 | OG6_101196 | 1 | 658 | 1977 | 72402 | 8.72 | 1 | | | GO:0016020 | membrane | GO:0005524;GO:0004222 | ATP binding;metalloendopeptidase activity | GO:0006508 | proteolysis | | | | | | | 3.4.24.- (Metalloendopeptidases.) | 3.4.24.- (Metalloendopeptidases.) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_IV011870ORcell division protein metalloprotease FtsH, putativeANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_IV011870 OR cell division protein metalloprotease FtsH, putative AND Babesia bovis T2Bo |
|
BBOV_V000160 | BBOV_V000160-t26_1 | 1 | 1 | 1 | | | reverse | protein coding | No | 1656 | BBOV_V000160 | clpC | clpC | 6993691 | A7AXE8 | Not Assigned | AAXT01000007:12,247..13,902(-) | AAXT01000007:12247..13902(-) | AAXT01000007 | Babesia bovis T2Bo | 27 | OG6_100223 | 4 | 551 | 1656 | 64623 | 9.68 | 0 | | | | | GO:0005524 | ATP binding | | | | | | | | | | 3.4.21.53 (Endopeptidase La) | https://pubmed.ncbi.nlm.nih.gov/?term=BBOV_V000160ORclpCANDBabesia bovis T2Bo | https://scholar.google.com/scholar?hl=en&as_sdt=0%2C5&q=BBOV_V000160 OR clpC AND Babesia bovis T2Bo |